PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00001.1.g10640.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 413aa    MW: 44271.7 Da    PI: 5.0564
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00001.1.g10640.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC69.25e-22174218145
                             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                     ++epgrCrRtDGKkWRC+r +++++k+C+rH+hrgr+r  + ++e
  Zjn_sc00001.1.g10640.1.sm.mkhc 174 EPEPGRCRRTDGKKWRCWRSTIPNEKYCQRHMHRGRKRPVQLVVE 218
                                     69************************************9998875 PP

2WRC63.43.4e-20331375145
                             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                     ++epgrCrRtDGKkWRC r +++++k+C+ H+hrgr+r  + ++e
  Zjn_sc00001.1.g10640.1.sm.mkhc 331 EPEPGRCRRTDGKKWRCCRSTIPNEKYCQGHMHRGRKRPVQLVVE 375
                                     69************************************9998875 PP

3QLQ522.2e-18108143237
                             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                      FTa+Qlq+L++Q  +y+y+aa++PvP +L+++i+k
  Zjn_sc00001.1.g10640.1.sm.mkhc 108 LFTAMQLQELEQQSRVYQYMAARVPVPTHLVFPIWK 143
                                     6*********************************97 PP

4QLQ46.88.7e-17266300337
                             QLQ   3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                     F a+Qlq+L++Q  +y+y+aa++PvP +L+++i+k
  Zjn_sc00001.1.g10640.1.sm.mkhc 266 FAAMQLQELEQQSKVYQYMAARVPVPTHLVFPIWK 300
                                     889******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.0E-7107143IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.602108143IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.4E-11109142IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166721.796174218IPR014977WRC domain
PfamPF088799.2E-19175213IPR014977WRC domain
SMARTSM009515.1E-6264300IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.983265300IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.5E-10266299IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166720.829331375IPR014977WRC domain
PfamPF088797.6E-18332370IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MAEEGESMNP VGGGGGGDNY PQEAAAAAAE EAAQGAVAQG GGHELAEEMA NREGAGAGED  60
DDACRDLVLI EDPEAVAVED PEEATASAAL QEEMKALIAS IPDGAGALFT AMQLQELEQQ  120
SRVYQYMAAR VPVPTHLVFP IWKSVTGASF EGAQKYPTLM GLATLCLDFG KDPEPEPGRC  180
RRTDGKKWRC WRSTIPNEKY CQRHMHRGRK RPVQLVVEDD EPDSASGSKT TPGKADDKNA  240
TAAAAALQEE MKALKASIPD GAGAVFAAMQ LQELEQQSKV YQYMAARVPV PTHLVFPIWK  300
SVTGASSEGA QKYPTLMGLA TLCLDFGKDP EPEPGRCRRT DGKKWRCCRS TIPNEKYCQG  360
HMHRGRKRPV QLVVEDDEPD SASGSKTTPG KADDKNASNK KLTVAAPAAV KSS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957654.11e-127PREDICTED: growth-regulating factor 11-like
SwissprotQ6AWX81e-109GRF11_ORYSJ; Growth-regulating factor 11
TrEMBLK3ZW281e-127K3ZW28_SETIT; Uncharacterized protein
STRINGSi030809m1e-127(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67353152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-28growth-regulating factor 5